PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do013483.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family bZIP
Protein Properties Length: 320aa    MW: 34720.8 Da    PI: 6.2496
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do013483.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1231.7e-071872361463
                 HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1  14 ReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                 R + +rsR RK+++i+eLe+ v++L++   +L+ ++ +l ++  +l +e+
  Do013483.1 187 RRSGQRSRVRKLQYIAELERTVDSLQNMGADLAVRVASLFQLHNALSMEN 236
                 67889***************************999999999888888877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd147034.64E-17186230No hitNo description
Gene3DG3DSA:1.20.5.1706.0E-5187246No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MSRSPHLPPR CPPLGPQITR RDDSLFTQSC RFPSGDPFFG EPPCWLDDLL ADSGKVPSLP  60
PLRRACSDSD AILDALSTFQ SPIHPIAEGD LSLGGEADDL FDAVEGGESG SVVEASCVYG  120
PNSPRQKSRL TTSESSMVNA VLENIPSNPL QYLTIDASSG VSGNVANGTA DASDAFGHPD  180
QDKSFKRRSG QRSRVRKLQY IAELERTVDS LQNMGADLAV RVASLFQLHN ALSMENEQLR  240
IQICNLQHAK LMKDGQTQAL KNEAERLKQM SARHRRSRSV TSCYNPSPYG DTSAVNWQMP  300
DMAKLSLNGS SVSPRGGYGL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1186192RRSGQRS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004952673.10.0PREDICTED: basic leucine zipper 34
TrEMBLK3YU630.0K3YU63_SETIT; Uncharacterized protein
STRINGSi017809m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP81372631
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42380.28e-17bZIP family protein